Anti-IL36G

Catalog Number: ATA-HPA068168
Article Name: Anti-IL36G
Biozol Catalog Number: ATA-HPA068168
Supplier Catalog Number: HPA068168
Alternative Catalog Number: ATA-HPA068168-100,ATA-HPA068168-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: IL-1F9, IL-1H1, IL-1RP2, IL1E, IL1F9, IL1H1
Clonality: Polyclonal
Concentration: 0,3
NCBI: 56300
UniProt: Q9NZH8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: AFPDWFIASSKRDQPIILTSELGKSYNTAFELNIND
Target: IL36G
HPA068168-100ul