Anti-LYPD1 Antibody , Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-LYPD1 Antibody , Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA068333
• Supplier Catalog Number: HPA068333
• Alternative Catalog Number: ATA-HPA068333-100,ATA-HPA068333-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: ICC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: LYPDC1, MGC29643

Product Properties

• Clonality: Polyclonal
• NCBI: 116372
• UniProt: Q8N2G4
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: GIMYRKSCASSAACLIASAGYQSFCSPGKLNSVCISCCNTPLCNGPRPKKRGSSASA
• Target: LYPD1