Anti-ING1, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-ING1, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA068363
• Supplier Catalog Number: HPA068363
• Alternative Catalog Number: ATA-HPA068363-100,ATA-HPA068363-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Human
• Alternative Names: p24ING1c, p33, p33ING1, p33ING1b, p47, p47ING1a

Product Description

Rabbit Polyclonal ING1 Antibody against Human inhibitor of growth family member 1. Validated for Western Blot

Product Properties

• Clonality: Polyclonal
• Concentration: 0.2
• NCBI: 3621
• UniProt: Q9UK53
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Sequence: VELFEAQQELGDTAGNSGKAGADRPKGEAAAQADKPNSKRSRRQRNNENRENASSNHDHDDGASGTPKEKKAKTSKKK