Anti-SOX17
Catalog Number:
ATA-HPA068399
- Images (8)
| Article Name: | Anti-SOX17 |
| Biozol Catalog Number: | ATA-HPA068399 |
| Supplier Catalog Number: | HPA068399 |
| Alternative Catalog Number: | ATA-HPA068399-100,ATA-HPA068399-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ChIP, IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | SOX17 |
| SRY (sex determining region Y)-box 17 |
| Anti-SOX17 |
| Clonality: | Polyclonal |
| Concentration: | 0.7 mg/ml |
| Isotype: | IgG |
| NCBI: | 64321 |
| UniProt: | Q9H6I2 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | MSSPDAGYASDDQSQTQSALPAVMAGLGPCPWAESLSPIGDMKVKGE |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | SOX17 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemistry analysis in human fallopian tube and pancreas tissues using HPA068399 antibody. Corresponding SOX17 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human endometrium shows strong nuclear positivity in glandular cells. |
|
|
Immunohistochemical staining of human fallopian tube shows strong nuclear positivity in glandular cells. |
|
|
Immunohistochemical staining of human colon shows moderate to strong nuclear positivity in glandular cells. |
|
|
Immunohistochemical staining of human pancreas shows no positivity in exocrine glandular cells as expected. |
|
|
HPA068399-100ul |
|
|
HPA068399-100ul |
|
|
HPA068399-100ul |
Product Guarantee and Expert Support
