Anti-COL1A2

Catalog Number: ATA-HPA068494
Article Name: Anti-COL1A2
Biozol Catalog Number: ATA-HPA068494
Supplier Catalog Number: HPA068494
Alternative Catalog Number: ATA-HPA068494-100,ATA-HPA068494-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: OI4
Clonality: Polyclonal
Concentration: 0,2
NCBI: 1278
UniProt: P08123
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: GPPGVSGGGYDFGYDGDFYRADQPRSAPSLRPKDYEV
Target: COL1A2
HPA068494-100ul