Anti-LEP

Catalog Number: ATA-HPA068565
Article Name: Anti-LEP
Biozol Catalog Number: ATA-HPA068565
Supplier Catalog Number: HPA068565
Alternative Catalog Number: ATA-HPA068565-100,ATA-HPA068565-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: OB, OBS
Clonality: Polyclonal
Concentration: 0,6
NCBI: 3952
UniProt: P41159
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: IQISNDLENLRDLLHVLAFSKSCHLPWASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLSPGC
Target: LEP
HPA068565-100ul