Anti-CUZD1

Product Overview

• Article Name: Anti-CUZD1
• Biozol Catalog Number: ATA-HPA068660
• Supplier Catalog Number: HPA068660
• Alternative Catalog Number: ATA-HPA068660-100,ATA-HPA068660-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Sonstiges
• Application: IHC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: ERG-1, UO-44

Product Description

CUB and zona pellucida-like domains 1

Additional Information

Anti-CUZD1

Product Properties

• Clonality: Polyclonal
• Concentration: 0.2 mg/ml
• Isotype: IgG
• NCBI: 50624
• UniProt: Q86UP6
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: CKVLICDSSDHQSRCNQGCVSRSKRDISSYKWKTDSIIGPIRLKRDRSASGNSGFQHETHAEETPNQP
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: CUZD1
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: IHC: 1:500 - 1:1000

Images

Immunohistochemistry analysis in human pancreas and colon tissues using Anti-CUZD1 antibody. Corresponding CUZD1 RNA-seq data are presented for the same tissues.

Immunohistochemical staining of human cerebral cortex, lymph node, pancreas and testis using Anti-CUZD1 antibody HPA068660 (A) shows similar protein distribution across tissues to independent antibody HPA068479 (B).

Immunohistochemical staining of human pancreas shows high expression.

Immunohistochemical staining of human colon shows low expression as expected.

Immunohistochemical staining of human cerebral cortex using Anti-CUZD1 antibody HPA068660.

Immunohistochemical staining of human testis using Anti-CUZD1 antibody HPA068660.

Immunohistochemical staining of human lymph node using Anti-CUZD1 antibody HPA068660.

HPA068660-100ul

HPA068660-100ul

HPA068660-100ul