Anti-HPX

Catalog Number: ATA-HPA068847
Article Name: Anti-HPX
Biozol Catalog Number: ATA-HPA068847
Supplier Catalog Number: HPA068847
Alternative Catalog Number: ATA-HPA068847-100,ATA-HPA068847-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Clonality: Polyclonal
Isotype: IgG
NCBI: 3263
UniProt: P02790
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: ECHRGECQAEGVLFFQGDREWFWDLATGTMKERSWPAVGNCSSALRWLGRYYCFQGNQFLRFDPVRGEVPPRYPRDVRDYFMPCP
Target: HPX
Antibody Type: Monoclonal Antibody
HPA068847-100ul