Anti-VHL

Catalog Number: ATA-HPA068954
Article Name: Anti-VHL
Biozol Catalog Number: ATA-HPA068954
Supplier Catalog Number: HPA068954
Alternative Catalog Number: ATA-HPA068954-100,ATA-HPA068954-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: VHL1
Clonality: Polyclonal
Concentration: 0,2
NCBI: 7428
UniProt: P40337
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: RRAENWDEAEVGAEEAGVEEYGPEEDGGEESGAEESGPEESGPEELGAEEEMEAG
Target: VHL
HPA068954-100ul