Anti-MSI2

Catalog Number: ATA-HPA068990
Article Name: Anti-MSI2
Biozol Catalog Number: ATA-HPA068990
Supplier Catalog Number: HPA068990
Alternative Catalog Number: ATA-HPA068990-100,ATA-HPA068990-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Clonality: Polyclonal
Isotype: IgG
NCBI: 124540
UniProt: Q96DH6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: NFVATYGRGYPGFAPSYGYQFPGFPAAAYGPVAAA
Target: MSI2
Antibody Type: Monoclonal Antibody
HPA068990-100ul