Anti-STH

Catalog Number: ATA-HPA069024
Article Name: Anti-STH
Biozol Catalog Number: ATA-HPA069024
Supplier Catalog Number: HPA069024
Alternative Catalog Number: ATA-HPA069024-100,ATA-HPA069024-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: MAPTIT
Clonality: Polyclonal
Concentration: 0,1
NCBI: 246744
UniProt: Q8IWL8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: YSSEESSRNGAEQGRQLSIEGPFQGQNCPSHPAAALPLPMRGESQATSCQV
Target: STH
HPA069024-100ul