Anti-NCAPH2
Catalog Number:
ATA-HPA069056
- Images (10)
| Article Name: | Anti-NCAPH2 |
| Biozol Catalog Number: | ATA-HPA069056 |
| Supplier Catalog Number: | HPA069056 |
| Alternative Catalog Number: | ATA-HPA069056-100,ATA-HPA069056-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | ICC, IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | 384D8-2, CAP-H2, hCAP-H2 |
| non-SMC condensin II complex, subunit H2 |
| Anti-NCAPH2 |
| Clonality: | Polyclonal |
| Concentration: | 0.4 mg/ml |
| Isotype: | IgG |
| NCBI: | 29781 |
| UniProt: | Q6IBW4 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | EAENEFLSLDDFPDSRTNVDLKNDQTPSEVLIIPLLPMALVAPDEMEKNNNPLYSRQGEVLASRKDFRMNTCVPHPRGAFMLEPEGMS |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | NCAPH2 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:1000 - 1:2500, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm & cell junctions. |
|
|
Immunohistochemistry analysis in human bone marrow and pancreas tissues using Anti-NCAPH2 antibody. Corresponding NCAPH2 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human bone marrow shows high expression. |
|
|
Immunohistochemical staining of human pancreas shows low expression as expected. |
|
|
Western blot analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-NCAPH2 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH. |
|
|
HPA069056-100ul |
|
|
|
|
|
|
|
|
HPA069056-100ul |
|
|
HPA069056-100ul |
Product Guarantee and Expert Support
