Anti-HOXA13

Catalog Number: ATA-HPA069061
Article Name: Anti-HOXA13
Biozol Catalog Number: ATA-HPA069061
Supplier Catalog Number: HPA069061
Alternative Catalog Number: ATA-HPA069061-100,ATA-HPA069061-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: HOX1, HOX1J
Clonality: Polyclonal
Isotype: IgG
NCBI: 3209
UniProt: P31271
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: LGLPMESYQPWALPNGWNGQMYCPKEQAQPPHLWKSTLPDVVSHPSDASSY
Target: HOXA13
Antibody Type: Monoclonal Antibody
HPA069061-100ul