Anti-SGO1

Catalog Number: ATA-HPA069302
Article Name: Anti-SGO1
Biozol Catalog Number: ATA-HPA069302
Supplier Catalog Number: HPA069302
Alternative Catalog Number: ATA-HPA069302-100,ATA-HPA069302-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: NY-BR-85, SGOL1
Clonality: Polyclonal
Isotype: IgG
NCBI: 151648
UniProt: Q5FBB7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: SGMDPNSDDSSRNLFVKDLPQIPLEETELPGQGESFQIEDQIPTIPQDTLGVDFDSGEAKSTDNVLPRTVSVRSSLKKHCNSICQF
Target: SGO1
Antibody Type: Monoclonal Antibody
HPA069302-100ul