Anti-SLAMF1
Catalog Number:
ATA-HPA069319
- Images (7)
| Article Name: | Anti-SLAMF1 |
| Biozol Catalog Number: | ATA-HPA069319 |
| Supplier Catalog Number: | HPA069319 |
| Alternative Catalog Number: | ATA-HPA069319-100,ATA-HPA069319-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | CD150, SLAM |
| signaling lymphocytic activation molecule family member 1 |
| Anti-SLAMF1 |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 6504 |
| UniProt: | Q13291 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | KVLLPLTYERINKSMNKSIHIVVTMAKSLENSVENKIVSLDPSEAGPPRYLGDRYKFYLENLTLGIRESRKE |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | SLAMF1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:2500 - 1:5000 |
|
|
Immunohistochemistry analysis in human lymph node and testis tissues using Anti-SLAMF1 antibody. Corresponding SLAMF1 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human lymph node shows high expression. |
|
|
Immunohistochemical staining of human thymus shows stong nuclear and cytoplasmic positivity in cortical and medullary cells. |
|
|
Immunohistochemical staining of human testis shows low expression as expected. |
|
|
HPA069319-100ul |
|
|
HPA069319-100ul |
|
|
HPA069319-100ul |
Product Guarantee and Expert Support
