Anti-SNUPN

Catalog Number: ATA-HPA069478
Article Name: Anti-SNUPN
Biozol Catalog Number: ATA-HPA069478
Supplier Catalog Number: HPA069478
Alternative Catalog Number: ATA-HPA069478-100,ATA-HPA069478-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: RNUT1, SNURPORTIN-1, Snurportin1
Clonality: Polyclonal
Concentration: 0,1
NCBI: 10073
UniProt: O95149
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: RPYMVSDVLGVAVPAGPLTTKPDYAGHQLQQIMEHKKSQKEGMKEKLTHKASENGHYELEHLSTPKLKG
Target: SNUPN
HPA069478-100ul