Anti-MCOLN1

Catalog Number: ATA-HPA069495
Article Name: Anti-MCOLN1
Biozol Catalog Number: ATA-HPA069495
Supplier Catalog Number: HPA069495
Alternative Catalog Number: ATA-HPA069495-100,ATA-HPA069495-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: ML4, MLIV, MST080, MSTP080, TRPM-L1, TRPML1
Clonality: Polyclonal
Isotype: IgG
NCBI: 57192
UniProt: Q9GZU1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: FLLGYSDGADDTFAAYTREQLYQAIFHAVDQYLALPDVSLGRYAYVRGGGDPWTNGSGLALCQRYYHRGHVDPANDTFDIDPMVVTDC
Target: MCOLN1
Antibody Type: Monoclonal Antibody
HPA069495-100ul