Anti-SOCS6

Catalog Number: ATA-HPA069499
Article Name: Anti-SOCS6
Biozol Catalog Number: ATA-HPA069499
Supplier Catalog Number: HPA069499
Alternative Catalog Number: ATA-HPA069499-100,ATA-HPA069499-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: WB
Species Reactivity: Human
Alternative Names: CIS4, Cish4, HSPC060, SOCS4, SSI4, STAI4, STATI4
Rabbit Polyclonal SOCS6 Antibody against Human suppressor of cytokine signaling 6. Validated for Western Blot
Clonality: Polyclonal
Concentration: 0.1
NCBI: 9306
UniProt: O14544
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Sequence: PTNSEETCIKMEVRVKALVHSSSPSPALNGVRKDFHDLQSETTCQEQANSLKSSASHNGDLHLHLDEHVPVVIGLM
WB Image Caption 1