Anti-SOCS6
Catalog Number:
ATA-HPA069499
| Article Name: |
Anti-SOCS6 |
| Biozol Catalog Number: |
ATA-HPA069499 |
| Supplier Catalog Number: |
HPA069499 |
| Alternative Catalog Number: |
ATA-HPA069499-100,ATA-HPA069499-25 |
| Manufacturer: |
Atlas Antibodies |
| Host: |
Rabbit |
| Category: |
Sonstiges |
| Application: |
WB |
| Species Reactivity: |
Human |
| Alternative Names: |
CIS4, Cish4, HSPC060, SOCS4, SSI4, STAI4, STATI4 |
| Rabbit Polyclonal SOCS6 Antibody against Human suppressor of cytokine signaling 6. Validated for Western Blot |
| Clonality: |
Polyclonal |
| Concentration: |
0.1 |
| NCBI: |
9306 |
| UniProt: |
O14544 |
| Buffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Sequence: |
PTNSEETCIKMEVRVKALVHSSSPSPALNGVRKDFHDLQSETTCQEQANSLKSSASHNGDLHLHLDEHVPVVIGLM |
|
WB Image Caption 1 |