Anti-NOS1

Catalog Number: ATA-HPA069509
Article Name: Anti-NOS1
Biozol Catalog Number: ATA-HPA069509
Supplier Catalog Number: HPA069509
Alternative Catalog Number: ATA-HPA069509-100,ATA-HPA069509-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: nNOS, NOS
Clonality: Polyclonal
Isotype: IgG
NCBI: 4842
UniProt: P29475
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: DHLGVFPGNHEDLVNALIERLEDAPPVNQMVKVELLEERNTALGVISNWTDELRLPPCTIFQAFKYYLD
Target: NOS1
Antibody Type: Monoclonal Antibody
HPA069509-100ul