Anti-EFNA1

Catalog Number: ATA-HPA069549
Article Name: Anti-EFNA1
Biozol Catalog Number: ATA-HPA069549
Supplier Catalog Number: HPA069549
Alternative Catalog Number: ATA-HPA069549-100,ATA-HPA069549-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: ECKLG, EPLG1, LERK1, TNFAIP4
Clonality: Polyclonal
Isotype: IgG
NCBI: 1942
UniProt: P20827
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: RFTPFTLGKEFKEGHSYYYISKPIHQHEDRCLRLKVTVSGKITHSPQAHDNPQEKRLAADDPEVRVLHSIGHS
Target: EFNA1
Antibody Type: Monoclonal Antibody
HPA069549-100ul