Anti-SPSB4, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-SPSB4, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA069666
• Supplier Catalog Number: HPA069666
• Alternative Catalog Number: ATA-HPA069666-100
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Human
• Alternative Names: SSB-4

Product Description

Rabbit Polyclonal SPSB4 Antibody against Human splA/ryanodine receptor domain and SOCS box containing 4. Validated for Western Blot

Product Properties

• Clonality: Polyclonal
• Concentration: 0.05
• NCBI: 92369
• UniProt: Q96A44
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Sequence: YPVVSAVWGHCEVTMRYINGLDPEPLPLMDLCRRSIRSALGRQRLQDI