Anti-WARS2

Catalog Number: ATA-HPA069692
Article Name: Anti-WARS2
Biozol Catalog Number: ATA-HPA069692
Supplier Catalog Number: HPA069692
Alternative Catalog Number: ATA-HPA069692-100,ATA-HPA069692-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: TrpRS
tryptophanyl tRNA synthetase 2, mitochondrial
Anti-WARS2
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 10352
UniProt: Q9UGM6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: MELVQDLAQGFNKKYGEFFPVPESILTSMKKVKSLRDPSAKMSKSDPDKLATVRITDSPEEIVQKFRKAVTDFTSEVTYDPA
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: WARS2
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500
Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.
Immunohistochemistry analysis in human fallopian tube and pancreas tissues using Anti-WARS2 antibody. Corresponding WARS2 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human fallopian tube shows high expression.
Immunohistochemical staining of human pancreas shows low expression as expected.
HPA069692-100ul
HPA069692-100ul
HPA069692-100ul