Anti-CEP112

Catalog Number: ATA-HPA069724
Article Name: Anti-CEP112
Biozol Catalog Number: ATA-HPA069724
Supplier Catalog Number: HPA069724
Alternative Catalog Number: ATA-HPA069724-100,ATA-HPA069724-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: CCDC46, MGC33887
Clonality: Polyclonal
Concentration: 0,3
NCBI: 201134
UniProt: Q8N8E3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: LMPASLRQELEDTISSLKSQVNFLQKRASILQEELTTY
Target: CEP112
HPA069724-100ul