Anti-TEKT4

Catalog Number: ATA-HPA069872
Article Name: Anti-TEKT4
Biozol Catalog Number: ATA-HPA069872
Supplier Catalog Number: HPA069872
Alternative Catalog Number: ATA-HPA069872-100,ATA-HPA069872-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: MGC27019
Clonality: Polyclonal
Isotype: IgG
NCBI: 150483
UniProt: Q8WW24
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: QRTQQDSTRTVGERLQDTHSWKSELQREMEALAAETNLLLAQKQRLERALDATEVPFSITTDNLQCRER
Target: TEKT4
Antibody Type: Monoclonal Antibody
HPA069872-100ul