Anti-PKD2L1

Catalog Number: ATA-HPA070002
Article Name: Anti-PKD2L1
Biozol Catalog Number: ATA-HPA070002
Supplier Catalog Number: HPA070002
Alternative Catalog Number: ATA-HPA070002-100,ATA-HPA070002-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: PCL, PKD2L, PKDL, TRPP3
Clonality: Polyclonal
Concentration: 0,3
NCBI: 9033
UniProt: Q9P0L9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: YNKTLLRLRLRKERVSDVQKVLQGGEQEIQFEDFTNTLRELGHAEHEITELTATFTKFDRDGNRILDEKEQE
Target: PKD2L1
HPA070002-100ul