Anti-ADAMTS4
Catalog Number:
ATA-HPA070099
| Article Name: |
Anti-ADAMTS4 |
| Biozol Catalog Number: |
ATA-HPA070099 |
| Supplier Catalog Number: |
HPA070099 |
| Alternative Catalog Number: |
ATA-HPA070099-100 |
| Manufacturer: |
Atlas Antibodies |
| Host: |
Rabbit |
| Category: |
Sonstiges |
| Application: |
WB |
| Species Reactivity: |
Human |
| Alternative Names: |
ADAMTS-2, ADMP-1, KIAA0688 |
| Rabbit Polyclonal ADAMTS4 Antibody against Human ADAM metallopeptidase with thrombospondin type 1 motif 4. Validated for Western Blot |
| Clonality: |
Polyclonal |
| Concentration: |
0.05 |
| NCBI: |
9507 |
| UniProt: |
O75173 |
| Buffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Sequence: |
VEGLTVQYLGQAPELLGGAEPGTYLTGTINGDPESVASLHWDGGALLGVLQYRGAELHLQPLEGGTPNSAGGPGAHILRRKSPASGQGPMCN |
|
WB Image Caption 1 |