Anti-ADAMTS4

Catalog Number: ATA-HPA070099
Article Name: Anti-ADAMTS4
Biozol Catalog Number: ATA-HPA070099
Supplier Catalog Number: HPA070099
Alternative Catalog Number: ATA-HPA070099-100
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: WB
Species Reactivity: Human
Alternative Names: ADAMTS-2, ADMP-1, KIAA0688
Rabbit Polyclonal ADAMTS4 Antibody against Human ADAM metallopeptidase with thrombospondin type 1 motif 4. Validated for Western Blot
Clonality: Polyclonal
Concentration: 0.05
NCBI: 9507
UniProt: O75173
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Sequence: VEGLTVQYLGQAPELLGGAEPGTYLTGTINGDPESVASLHWDGGALLGVLQYRGAELHLQPLEGGTPNSAGGPGAHILRRKSPASGQGPMCN
WB Image Caption 1