Anti-ADAMTS4, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-ADAMTS4, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA070099
• Supplier Catalog Number: HPA070099
• Alternative Catalog Number: ATA-HPA070099-100
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Human
• Alternative Names: ADAMTS-2, ADMP-1, KIAA0688

Product Description

Rabbit Polyclonal ADAMTS4 Antibody against Human ADAM metallopeptidase with thrombospondin type 1 motif 4. Validated for Western Blot

Product Properties

• Clonality: Polyclonal
• Concentration: 0.05
• NCBI: 9507
• UniProt: O75173
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Sequence: VEGLTVQYLGQAPELLGGAEPGTYLTGTINGDPESVASLHWDGGALLGVLQYRGAELHLQPLEGGTPNSAGGPGAHILRRKSPASGQGPMCN