Anti-CUTA

Catalog Number: ATA-HPA070199
Article Name: Anti-CUTA
Biozol Catalog Number: ATA-HPA070199
Supplier Catalog Number: HPA070199
Alternative Catalog Number: ATA-HPA070199-100,ATA-HPA070199-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: ACHAP, C6orf82
Clonality: Polyclonal
Concentration: 0,05
NCBI: 51596
UniProt: O60888
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: LLPRVLLTMASGSPPTQPSPASDSGSGYVPGSVSAAFVTCPNEKVAKEIARAVVEKRLAACVNLIPQI
Target: CUTA
HPA070199-100ul