Anti-HRAS

Catalog Number: ATA-HPA070222
Article Name: Anti-HRAS
Biozol Catalog Number: ATA-HPA070222
Supplier Catalog Number: HPA070222
Alternative Catalog Number: ATA-HPA070222-100,ATA-HPA070222-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: HRAS1
Clonality: Polyclonal
Isotype: IgG
NCBI: 3265
UniProt: P01112
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: VREIRQHKLRKLNPPDESGPGCMSCKCVLS
Target: HRAS
Antibody Type: Monoclonal Antibody
HPA070222-100ul