Anti-AP1G1

Catalog Number: ATA-HPA070312
Article Name: Anti-AP1G1
Biozol Catalog Number: ATA-HPA070312
Supplier Catalog Number: HPA070312
Alternative Catalog Number: ATA-HPA070312-100,ATA-HPA070312-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: ADTG, CLAPG1
Clonality: Polyclonal
Concentration: 0,2
NCBI: 164
UniProt: O43747
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: VPELMEMFLPATKNLLNEKNHGVLHTSVVLLTEMCERSPDMLAHFRKNEKLVPQLVRILKNLIMSGYSPEHDVSGI
Target: AP1G1
HPA070312-100ul