Anti-TGM1

Catalog Number: ATA-HPA070372
Article Name: Anti-TGM1
Biozol Catalog Number: ATA-HPA070372
Supplier Catalog Number: HPA070372
Alternative Catalog Number: ATA-HPA070372-100,ATA-HPA070372-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: ICR2, LI, LI1, TGASE, TGK
Clonality: Polyclonal
Concentration: 0,1
NCBI: 7051
UniProt: P22735
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: DLSLTLLGAAVVGQECEVQIVFKNPLPVTLTNVVFRLEGSGLQRPKILNVGDIGGNETVTLRQSFVPVRPGPRQLIASLD
Target: TGM1
HPA070372-100ul