Anti-APBA2

Catalog Number: ATA-HPA070376
Article Name: Anti-APBA2
Biozol Catalog Number: ATA-HPA070376
Supplier Catalog Number: HPA070376
Alternative Catalog Number: ATA-HPA070376-100,ATA-HPA070376-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: D15S1518E, HsT16821, LIN-10, MGC:14091, MINT2, X11L
Clonality: Polyclonal
Isotype: IgG
NCBI: 321
UniProt: Q99767
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: AHRKLESVGSGMLDHRVRPGPVPHSQEPESEDMELPLEGYVPEGLELAALRPESPAPEEQECHNHSPDGDSSSDYVNNTSE
Target: APBA2
Antibody Type: Monoclonal Antibody
HPA070376-100ul