Anti-MUC5AC

Catalog Number: ATA-HPA070378
Article Name: Anti-MUC5AC
Biozol Catalog Number: ATA-HPA070378
Supplier Catalog Number: HPA070378
Alternative Catalog Number: ATA-HPA070378-100,ATA-HPA070378-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: MUC5
Clonality: Polyclonal
Concentration: 0,1
NCBI: 4586
UniProt: P98088
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: LLSHNTKLTPMEFGNLQKMDDPTEQCQDPVPEPPRNCSTGFGICEELLHGQLFSGCVALVDVGSYLEACRQDLCFCE
Target: MUC5AC
HPA070378-100ul