Anti-PIAS2, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-PIAS2, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA070620
• Supplier Catalog Number: HPA070620
• Alternative Catalog Number: ATA-HPA070620-100,ATA-HPA070620-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Human
• Alternative Names: ARIP3, miz, PIASX-ALPHA, PIASX-BETA, ZMIZ4

Product Description

Rabbit Polyclonal PIAS2 Antibody against Human protein inhibitor of activated STAT 2. Validated for Western Blot

Product Properties

• Clonality: Polyclonal
• Concentration: 0.1
• NCBI: 9063
• UniProt: O75928
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Sequence: MRPKKEAMKVSSQPCTKIESSSVLSKPCSVTVASEASKKKVDVI