Anti-SMNDC1

Catalog Number: ATA-HPA070666
Article Name: Anti-SMNDC1
Biozol Catalog Number: ATA-HPA070666
Supplier Catalog Number: HPA070666
Alternative Catalog Number: ATA-HPA070666-100,ATA-HPA070666-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: SMNR, SPF30, TDRD16C
Clonality: Polyclonal
Isotype: IgG
NCBI: 10285
UniProt: O75940
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: KELEQEREDQKVKWQQFNNRAYSKNKKGQVKRSIFASPESVTGKVGVGTCGIADKP
Target: SMNDC1
Antibody Type: Monoclonal Antibody
HPA070666-100ul