Anti-IGFLR1

Catalog Number: ATA-HPA070778
Article Name: Anti-IGFLR1
Biozol Catalog Number: ATA-HPA070778
Supplier Catalog Number: HPA070778
Alternative Catalog Number: ATA-HPA070778-100,ATA-HPA070778-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: FLJ22573, TMEM149, U2AF1L4
Clonality: Polyclonal
Concentration: 0,05
NCBI: 79713
UniProt: Q9H665
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: LEYWNPDNKCCSSCLQRFGPPPCPDYEFRENCGLNDHGDFVTPPFRKCSSGQCNPDGAELCS
Target: IGFLR1
HPA070778-100ul