Anti-TMPO

Catalog Number: ATA-HPA070805
Article Name: Anti-TMPO
Biozol Catalog Number: ATA-HPA070805
Supplier Catalog Number: HPA070805
Alternative Catalog Number: ATA-HPA070805-100,ATA-HPA070805-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: LAP2, LEMD4, TP
Clonality: Polyclonal
Isotype: IgG
NCBI: 7112
UniProt: P42167
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: IDGPVISESTPIAETIMASSNESLVVNRVTGNFKHASPILPITEFSDIPRRAPKKPLTRAEVGEKTEERRVERDIL
Target: TMPO
Antibody Type: Monoclonal Antibody
HPA070805-100ul