Anti-TSHZ3

Catalog Number: ATA-HPA071010
Article Name: Anti-TSHZ3
Biozol Catalog Number: ATA-HPA071010
Supplier Catalog Number: HPA071010
Alternative Catalog Number: ATA-HPA071010-100,ATA-HPA071010-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: KIAA1474, TSH3, ZNF537
Clonality: Polyclonal
Isotype: IgG
NCBI: 57616
UniProt: Q63HK5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: VDEGLDPEEHTADGEPSAKYMCPEKELARACPSYQNSPAAEFSCHEMDSESHISETSDRMADFESGSIKNEEETKEVTVPLED
Target: TSHZ3
Antibody Type: Monoclonal Antibody
HPA071010-100ul