Anti-NTS

Catalog Number: ATA-HPA071012
Article Name: Anti-NTS
Biozol Catalog Number: ATA-HPA071012
Supplier Catalog Number: HPA071012
Alternative Catalog Number: ATA-HPA071012-100,ATA-HPA071012-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Clonality: Polyclonal
Isotype: IgG
NCBI: 4922
UniProt: P30990
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: SDSEEEMKALEADFLTNMHTSKISKAHVPSWKMTLLNVCSLVNNLNSPAEETGEVHEEELVARRKLPTALD
Target: NTS
Antibody Type: Monoclonal Antibody
HPA071012-100ul