Anti-LNX2, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-LNX2, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA071073
• Supplier Catalog Number: HPA071073
• Alternative Catalog Number: ATA-HPA071073-100,ATA-HPA071073-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Human
• Alternative Names: MGC46315, PDZRN1

Product Description

Rabbit Polyclonal LNX2 Antibody against Human ligand of numb-protein X 2. Validated for Western Blot

Product Properties

• Clonality: Polyclonal
• Concentration: 0.2
• NCBI: 222484
• UniProt: Q8N448
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Sequence: SVCKDVMQRCDLEAHLKNRCPGASHRRVALERRKTSRTQAEIENENGPTLLDPAGTLSPEADCLGTGAVPVERHLTSAS