Anti-LNX2
Catalog Number:
ATA-HPA071073
| Article Name: |
Anti-LNX2 |
| Biozol Catalog Number: |
ATA-HPA071073 |
| Supplier Catalog Number: |
HPA071073 |
| Alternative Catalog Number: |
ATA-HPA071073-100,ATA-HPA071073-25 |
| Manufacturer: |
Atlas Antibodies |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Human |
| Alternative Names: |
MGC46315, PDZRN1 |
| Rabbit Polyclonal LNX2 Antibody against Human ligand of numb-protein X 2. Validated for Western Blot |
| Clonality: |
Polyclonal |
| Concentration: |
0.2 |
| NCBI: |
222484 |
| UniProt: |
Q8N448 |
| Buffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Sequence: |
SVCKDVMQRCDLEAHLKNRCPGASHRRVALERRKTSRTQAEIENENGPTLLDPAGTLSPEADCLGTGAVPVERHLTSAS |
|
WB Image Caption 1 |