Anti-KCNQ1

Catalog Number: ATA-HPA071107
Article Name: Anti-KCNQ1
Biozol Catalog Number: ATA-HPA071107
Supplier Catalog Number: HPA071107
Alternative Catalog Number: ATA-HPA071107-100,ATA-HPA071107-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: JLNS1, KCNA8, KCNA9, Kv7.1, KVLQT1, LQT, LQT1
Clonality: Polyclonal
Concentration: 0,5
NCBI: 3784
UniProt: P51787
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: YSQGHLNLMVRIKELQRRLDQSIGKPSLFISVSEKSKDRGSNTIGARLNRVEDKVTQLDQ
Target: KCNQ1
HPA071107-100ul