Anti-NCL

Catalog Number: ATA-HPA071110
Article Name: Anti-NCL
Biozol Catalog Number: ATA-HPA071110
Supplier Catalog Number: HPA071110
Alternative Catalog Number: ATA-HPA071110-100,ATA-HPA071110-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: C23, Nsr1
Clonality: Polyclonal
Isotype: IgG
NCBI: 4691
UniProt: P19338
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: LEKPKGKDSKKERDARTLLAKNLPYKVTQDELKEVFEDAAEIRLVSKDGKSKGIAYIEFKTEADAEKTFEEKQGTEIDGRSISLYY
Target: NCL
Antibody Type: Monoclonal Antibody
HPA071110-100ul