Anti-TRPM1

Catalog Number: ATA-HPA071139
Article Name: Anti-TRPM1
Biozol Catalog Number: ATA-HPA071139
Supplier Catalog Number: HPA071139
Alternative Catalog Number: ATA-HPA071139-100,ATA-HPA071139-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: CSNB1C, LTRPC1, MLSN1
Clonality: Polyclonal
Isotype: IgG
NCBI: 4308
UniProt: Q7Z4N2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: NAEESKLGPDIGISKEDDERQTDSKKEETISPSLNKTDVIHGQDKSDVQNTQLTVETTNIEGTISYPLEETKITRYFPDETINACKTMKSRSFVYSR
Target: TRPM1
Antibody Type: Monoclonal Antibody
HPA071139-100ul