Anti-SKOR1

Catalog Number: ATA-HPA071150
Article Name: Anti-SKOR1
Biozol Catalog Number: ATA-HPA071150
Supplier Catalog Number: HPA071150
Alternative Catalog Number: ATA-HPA071150-100,ATA-HPA071150-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: CORL1, FUSSEL15, LBXCOR1
Clonality: Polyclonal
Isotype: IgG
NCBI: 390598
UniProt: P84550
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: GPDGEQPTGPPSATSSGADGPANSPDGGSPRPRRRLGPPPAGRPAFGDLAAEDLVRRPERSPPSGGGGYELR
Target: SKOR1
Antibody Type: Monoclonal Antibody
HPA071150-100ul