Anti-ZP3
Catalog Number:
ATA-HPA071198
| Article Name: |
Anti-ZP3 |
| Biozol Catalog Number: |
ATA-HPA071198 |
| Supplier Catalog Number: |
HPA071198 |
| Alternative Catalog Number: |
ATA-HPA071198-100,ATA-HPA071198-25 |
| Manufacturer: |
Atlas Antibodies |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
IHC |
| Species Reactivity: |
Human |
| Immunogen: |
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: |
Unconjugated |
| Alternative Names: |
ZP3-372, ZP3-424, ZP3A, ZP3B, ZPC |
| Clonality: |
Polyclonal |
| Concentration: |
0,1 |
| NCBI: |
7784 |
| UniProt: |
P21754 |
| Buffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: |
Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: |
CLVDGLTDASSAFKVPRPGPDTLQFTVDVFHFANDSRNMIYITCHLKVTLAEQDPDELNKACSFSKPSNSWFPVEG |
| Target: |
ZP3 |
|
HPA071198-100ul |