Anti-LIPM

Catalog Number: ATA-HPA071276
Article Name: Anti-LIPM
Biozol Catalog Number: ATA-HPA071276
Supplier Catalog Number: HPA071276
Alternative Catalog Number: ATA-HPA071276-100,ATA-HPA071276-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: bA304I5.1, LIPL3
Clonality: Polyclonal
Concentration: 0,2
NCBI: 340654
UniProt: Q5VYY2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: SVHMPTKAVDPEAFMNISEIIQHQGYPCEEYEVATE
Target: LIPM
HPA071276-100ul