Anti-ZBTB8B

Catalog Number: ATA-HPA071427
Article Name: Anti-ZBTB8B
Biozol Catalog Number: ATA-HPA071427
Supplier Catalog Number: HPA071427
Alternative Catalog Number: ATA-HPA071427-100,ATA-HPA071427-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: DKFZp547H154, RP1-27O5.1, ZNF916B
Clonality: Polyclonal
Concentration: 0,2
NCBI: 728116
UniProt: Q8NAP8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: AVDLAYSNYHVKQFLEALLRNSAAPSKDDADHHFSRSLEGRPEGAGVAMSSMMDVQADWYGEDSGDVLVVP
Target: ZBTB8B
HPA071427-100ul