Anti-HSPBP1

Catalog Number: ATA-HPA071444
Article Name: Anti-HSPBP1
Biozol Catalog Number: ATA-HPA071444
Supplier Catalog Number: HPA071444
Alternative Catalog Number: ATA-HPA071444-100,ATA-HPA071444-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: FES1, HspBP1
HSPA (heat shock 70kDa) binding protein, cytoplasmic cochaperone 1
Anti-HSPBP1
Clonality: Polyclonal
Concentration: 0.2 mg/ml
Isotype: IgG
NCBI: 23640
UniProt: Q9NZL4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: KLKVKSAFLLQNLLVGHPEHKGTLCSMGMVQQLVALVRTEHSPFHEHVLGALCSLVTDFPQGVRECREPELGLEELLRHRCQLLQQHEEYQEELEFCEKLLQT
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: HSPBP1
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human testis and pancreas tissues using Anti-HSPBP1 antibody. Corresponding HSPBP1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human testis shows high expression.
Immunohistochemical staining of human pancreas shows low expression as expected.
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251 MG
HPA071444-100ul
HPA071444-100ul
HPA071444-100ul