Anti-FOXI1

Catalog Number: ATA-HPA071469
Article Name: Anti-FOXI1
Biozol Catalog Number: ATA-HPA071469
Supplier Catalog Number: HPA071469
Alternative Catalog Number: ATA-HPA071469-100,ATA-HPA071469-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: FKHL10, FREAC6
forkhead box I1
Anti-FOXI1
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 2299
UniProt: Q12951
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: TSHPLVTPGLSPEPSDKTGQNSLTFNSFSPLTNLSNHSGGGDWANPMPTNMLSYGGSVLSQFSPHFYNSVNTSG
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: FOXI1
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoli & vesicles.
Immunohistochemistry analysis in human kidney and liver tissues using HPA071469 antibody. Corresponding FOXI1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human kidney shows moderate nuclear positivity in a subset of cells in tubules.
Immunohistochemical staining of human salivary gland shows moderate nuclear positivity in a subset of glandular cells.
Immunohistochemical staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemical staining of human cerebellum shows no positivity in Purkinje cells as expected.
HPA071469-100ul
HPA071469-100ul
HPA071469-100ul