Anti-SMURF2
Catalog Number:
ATA-HPA071508
- Images (10)
| Article Name: | Anti-SMURF2 |
| Biozol Catalog Number: | ATA-HPA071508 |
| Supplier Catalog Number: | HPA071508 |
| Alternative Catalog Number: | ATA-HPA071508-100,ATA-HPA071508-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | ICC, IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | SMURF2 |
| SMAD specific E3 ubiquitin protein ligase 2 |
| Anti-SMURF2 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 64750 |
| UniProt: | Q9HAU4 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | LSCFVDENTPISGTNGATCGQSSDPRLAERRVRSQRHRNYMSRTHLHTPPD |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | SMURF2 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line BJ shows localization to nuclear speckles. |
|
|
Immunohistochemistry analysis in human testis and skeletal muscle tissues using Anti-SMURF2 antibody. Corresponding SMURF2 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human testis shows high expression. |
|
|
Immunohistochemical staining of human skeletal muscle shows low expression as expected. |
|
|
Western blot analysis in human cell line RT-4 and human cell line U-251 MG. |
|
|
|
|
|
HPA071508-100ul |
|
|
|
|
|
HPA071508-100ul |
|
|
HPA071508-100ul |
Product Guarantee and Expert Support
