Anti-ING1
Catalog Number:
ATA-HPA071589
| Article Name: |
Anti-ING1 |
| Biozol Catalog Number: |
ATA-HPA071589 |
| Supplier Catalog Number: |
HPA071589 |
| Alternative Catalog Number: |
ATA-HPA071589-100 |
| Manufacturer: |
Atlas Antibodies |
| Host: |
Rabbit |
| Category: |
Sonstiges |
| Application: |
WB |
| Species Reactivity: |
Human |
| Alternative Names: |
p24ING1c, p33, p33ING1, p33ING1b, p47, p47ING1a |
| Rabbit Polyclonal ING1 Antibody against Human inhibitor of growth family member 1. Validated for Western Blot |
| Clonality: |
Polyclonal |
| Concentration: |
0.05 |
| NCBI: |
3621 |
| UniProt: |
Q9UK53 |
| Buffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Sequence: |
MSFVECPYHSPAERLVAEADEGGPSAITGMGLCFRCLLFSFSGRSGVEGGRVDLNVFGSLGLQPWIGSSRC |
![]()
|
WB Image Caption 1 |
